DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31294 and spag

DIOPT Version :10

Sequence 1:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster


Alignment Length:199 Identity:46/199 - (23%)
Similarity:82/199 - (41%) Gaps:46/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DVMKQLEDLQNANKMDTGTKGKEEKKPEVDPSEGVTITNFMVFARDVRKKSSRYLKRVQK--MSN 78
            ::.:|:.  |||.:.:...|                  :...:.:|::.|.    |.:||  :|.
  Fly     9 ELQRQVR--QNAREYENSVK------------------DLYSWEQDIKNKE----KELQKSPLSA 49

  Fly    79 INQISFMRQIDVSPKDRAEA-----------RRDREI--VADSFRRL------GNEEYRRTNYEK 124
            .|:...:|....:.|.|.|:           ::|..:  ||..:::.      ||...::..|||
  Fly    50 ANKDLPVRSHVQTDKSRKESPSSSAASSPTEKQDLPVDPVAQQYKKANDIKDRGNTYVKQGEYEK 114

  Fly   125 AVYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFNLDPIHLRAWLYRAGALARLN 189
            |:..||.||......|:.:.||||..:|:..|...:.|.:..| .||.:.::|:..|..|...|.
  Fly   115 AIVAYSTAIAVYPHDPIYHINRALCYLKQESFDQCVEDCEAAI-ALDKLCVKAYYRRMQANESLG 178

  Fly   190 NESE 193
            |..|
  Fly   179 NNME 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31294NP_732055.1 NlpI <106..>199 CDD:443815 28/94 (30%)
TPR repeat 106..134 CDD:276809 10/33 (30%)
TPR repeat 139..170 CDD:276809 9/30 (30%)
spagNP_524664.1 TPR repeat 96..124 CDD:276809 9/27 (33%)
TPR 102..>211 CDD:440225 27/82 (33%)
TPR repeat 129..159 CDD:276809 9/30 (30%)
TPR repeat 164..192 CDD:276809 6/19 (32%)
PLN03209 <296..416 CDD:178748
RPAP3_C 416..503 CDD:464012
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.