DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31294 and Stip1

DIOPT Version :10

Sequence 1:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_058017.1 Gene:Stip1 / 20867 MGIID:109130 Length:543 Species:Mus musculus


Alignment Length:349 Identity:65/349 - (18%)
Similarity:115/349 - (32%) Gaps:146/349 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ADESFLN----------------QRSLLMD-----VMKQLED--------LQNANKM-------- 30
            |:..|:|                .||||.|     :::||::        ||:...|        
Mouse   120 AERKFMNPFNLPNLYQKLENDPRTRSLLSDPTYRELIEQLQNKPSDLGTKLQDPRVMTTLSVLLG 184

  Fly    31 -DTGTKGKEE------------KKPEVDPSEGVTITN------FMVFARDVRKKSS-----RYLK 71
             |.|:..:||            |:|:.:|.|.....|      ......|..||..     ::..
Mouse   185 VDLGSMDEEEEAATPPPPPPPKKEPKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDKALKHYD 249

  Fly    72 RVQKMSNINQISFMRQ--------------------IDVSPKDRAEARRDREIVADSFRRLGNEE 116
            |.:::...|......|                    |:|..::|.:.|:    :|.::.|:||..
Mouse   250 RAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRENREDYRQ----IAKAYARIGNSY 310

  Fly   117 YRRTNYEKAVYFYSKA-------------------------IQYV------------------AD 138
            ::...|:.|::||:|:                         :.|:                  .|
Mouse   311 FKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGD 375

  Fly   139 SP-----------------VLYCNRALAKIKKRDFKLALFDLDYVIFNLDPIHLRAWLYRAGALA 186
            .|                 .||.|||....|..:|:|||.|.:..| .|:|..::.:..:|.||.
Mouse   376 YPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECI-QLEPTFIKGYTRKAAALE 439

  Fly   187 RLNNESEFEIAIANARLLNRSQKD 210
            .:.:.::.......|..|:.|.|:
Mouse   440 AMKDYTKAMDVYQKALDLDSSCKE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31294NP_732055.1 NlpI <106..>199 CDD:443815 29/152 (19%)
TPR repeat 106..134 CDD:276809 9/52 (17%)
TPR repeat 139..170 CDD:276809 13/47 (28%)
Stip1NP_058017.1 TPR 1 4..37
3a0801s09 <7..532 CDD:273380 65/349 (19%)
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR 2 39..71
TPR repeat 72..100 CDD:276809
TPR 3 73..105
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..233 7/41 (17%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 222..239 2/16 (13%)
TPR 4 225..258 4/32 (13%)
TPR repeat 229..253 CDD:276809 4/23 (17%)
TPR repeat 258..288 CDD:276809 3/29 (10%)
TPR 5 260..292 3/31 (10%)
TPR 6 300..333 9/32 (28%)
TPR repeat 300..328 CDD:276809 9/27 (33%)
TPR 7 360..393 2/32 (6%)
TPR repeat 364..388 CDD:276809 2/23 (9%)
TPR repeat 393..423 CDD:276809 12/30 (40%)
TPR 8 395..427 14/32 (44%)
TPR 9 428..461 5/32 (16%)
TPR repeat 428..456 CDD:276809 4/27 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.