DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31294 and rpap-3

DIOPT Version :10

Sequence 1:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_501282.1 Gene:rpap-3 / 183187 WormBaseID:WBGene00016375 Length:297 Species:Caenorhabditis elegans


Alignment Length:152 Identity:36/152 - (23%)
Similarity:64/152 - (42%) Gaps:36/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VADSFRRLGNEEYRRTNYEKAVYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFN 169
            :|...:..|||.:::..|.||:..|||::::..| |:::.|||.|.:......||..|....: |
 Worm     7 IAQRLKEQGNEAFKKKKYHKAMTIYSKSLEHWPD-PIVFSNRAQAGLNADLPLLAQIDCTAAL-N 69

  Fly   170 LDPIHLRAWLYRAGALARL----------------NNESEFE-----------IAIANARLLNRS 207
            ||....:|:..||.|...|                :|:...|           :.:.:...:.|.
 Worm    70 LDSTAAKAYYRRAQAFKALELYELAERDMKTCFKYSNDPNMERQANDLKGKKNVQVIDLPSIERD 134

  Fly   208 ---QKDKKYIE----YFLEKFK 222
               |.|:|:.:    |.:||.:
 Worm   135 EYLQSDEKFTKIDFTYNIEKIE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31294NP_732055.1 NlpI <106..>199 CDD:443815 29/119 (24%)
TPR repeat 106..134 CDD:276809 10/27 (37%)
TPR repeat 139..170 CDD:276809 8/30 (27%)
rpap-3NP_501282.1 3a0801s09 2..>98 CDD:273380 27/92 (29%)
TPR repeat 8..36 CDD:276809 10/27 (37%)
TPR repeat 40..70 CDD:276809 9/31 (29%)
TPR repeat 75..103 CDD:276809 5/27 (19%)
RPAP3_C 181..273 CDD:464012
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.