DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31294 and sgt-1

DIOPT Version :10

Sequence 1:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_494893.1 Gene:sgt-1 / 173846 WormBaseID:WBGene00019893 Length:337 Species:Caenorhabditis elegans


Alignment Length:108 Identity:33/108 - (30%)
Similarity:50/108 - (46%) Gaps:4/108 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ADSFRRLGNEEYRRTNYEKAVYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFNL 170
            |:..:..||:..:.:.:|.||..|:.||:...| ||.:||||.|..:...:.||:.|....: .|
 Worm   105 ANKLKEEGNDLMKASQFEAAVQKYNAAIKLNRD-PVYFCNRAAAYCRLEQYDLAIQDCRTAL-AL 167

  Fly   171 DPIHLRAWLYRAGALARLNNESEFEIAIANARLLNRSQKDKKY 213
            ||.:.:|| .|.|......|..| ..|.|..:.|......:.|
 Worm   168 DPSYSKAW-GRMGLAYSCQNRYE-HAAEAYKKALELEPNQESY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31294NP_732055.1 NlpI <106..>199 CDD:443815 30/92 (33%)
TPR repeat 106..134 CDD:276809 8/27 (30%)
TPR repeat 139..170 CDD:276809 10/30 (33%)
sgt-1NP_494893.1 Spy 31..>212 CDD:443119 33/108 (31%)
TPR repeat 105..133 CDD:276809 8/27 (30%)
TPR repeat 137..167 CDD:276809 11/31 (35%)
TPR repeat 172..200 CDD:276809 8/29 (28%)

Return to query results.
Submit another query.