DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and pkdc

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:314 Identity:63/314 - (20%)
Similarity:102/314 - (32%) Gaps:96/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 MLRVYIKLEMKDGSVKTKTYIFKTMLPEER---GG--SDIN---EFGLFPKEAMMYKTYLPAFEA 114
            ::||::     :|..:....:...|.|:.:   ||  :||:   :...:..|...|:.|......
Zfish    34 IIRVHL-----EGCDRPSVVVKHVMFPQNQKHPGGWNTDISHQRKVRSYQVETYWYQNYTTNENC 93

  Fly   115 LYKDVGWDIQLAPKCLHTEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHA-- 177
                      ..|.||..:....:...:.|||.|..|. :.:|...|.| :..||..:|.:||  
Zfish    94 ----------RVPLCLAAKSFGEEQLIVLEDLDVAGFP-VRKTYVNDAE-IKACLSWIANFHALF 146

  Fly   178 ASAVYEELH--GPYPSEFSEGFVKKDVKKFHVDGFQLKEKAYKKAMLSWGLKDADKYIKAFPTVK 240
            .....|.|.  |.|                                  |.|:...:.::|....|
Zfish   147 LDVTPEGLWPIGTY----------------------------------WHLETRPEELEAMSDQK 177

  Fly   241 QYWAQCLSTLELNPDEFHVLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLT 305
            ...|.......||...|..:.|||...:|...|  .||.  ::..:|||.|..|....|:::||.
Zfish   178 LKAAAGEIDSILNNCRFKTIVHGDAKLANFCFS--KDGL--QVASVDFQYVGGGCGMKDVIYFLG 238

  Fly   306 LSPTNDLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRD-----LQNSMNNK 354
                                    .|:...:.:|..|.|.|     |:.|:..|
Zfish   239 ------------------------SCMDERECEKKAPGLLDYYFSELRKSLEKK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 55/284 (19%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 50/234 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.