DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG31097

DIOPT Version :10

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:92 Identity:20/92 - (21%)
Similarity:31/92 - (33%) Gaps:33/92 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 DCVACDSTFGTFSSCLVAHFVIIQERFE------------GLRFDDGNRELKKLIEHHKY----- 234
            :||..:|....|.:  :.:|..||:.|.            ||....|.|:...|:|....     
  Fly   220 ECVLKNSQLCHFHN--ITNFDAIQQFFAIHGSAEGYRVYVGLNVRQGVRKPNPLLEDQNLSCVRQ 282

  Fly   235 ------------ILRISDRVINAYKNV 249
                        :.:..||  |.|:||
  Fly   283 LLNLGITPFPYKVAKALDR--NIYRNV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKL 50..331 CDD:397213 20/92 (22%)
CG31097NP_733093.2 EcKL 46..331 CDD:397213 20/92 (22%)

Return to query results.
Submit another query.