DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG13658

DIOPT Version :10

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:34 Identity:10/34 - (29%)
Similarity:16/34 - (47%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 LYYESTQVHDAVFKSKWYDASVATQKMLINCMMR 334
            ||..|.|::.||.|.......::.|...::|..|
  Fly   270 LYKSSKQLYKAVAKECGITCKMSDQCRCLDCQSR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKL 50..331 CDD:397213 8/29 (28%)
CG13658NP_651374.2 EcKL 52..341 CDD:397213 10/34 (29%)

Return to query results.
Submit another query.