DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG13658

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:391 Identity:100/391 - (25%)
Similarity:172/391 - (43%) Gaps:38/391 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDNDDIVNPN-EHLIIPDWINEKYFESVLAKDEPD---HVKVLKFTVVAAIPPGENFTSTMLRV 61
            |::|.|....| :.:..|.|:|.:..|..|...|.|   ||..||  :..|...|:::.|.|.|.
  Fly     1 MAENVDSAQFNADEVDAPAWLNAELIEGALRAYEKDPELHVTDLK--ISPATLQGDHYASVMFRA 63

  Fly    62 YIKLEMKDGSVKTKTYIFKTMLPEERGGSD--INEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQ 124
            ........|:. :|..|.||| ||:.|...  ::...:|..|.:||...||..|.:.::.|...:
  Fly    64 VSHYSTAKGNF-SKALIVKTM-PEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTK 126

  Fly   125 LAPKCLHTEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPY 189
            |...|::.......: .||||| |.:...:.|.:..:.|.:.|...|||::||||.........:
  Fly   127 LYAPCIYHSLEPHQV-MIFEDL-VPQGYTVIRDRYPNKEELQKAFFKLAKWHAASMKVLNERPDF 189

  Fly   190 PSEFSEG------FVKKDVKKFHVDGF-QLKEKAYKKAMLSWGLKDADKYIKAFPTVKQYWAQCL 247
            ..||..|      |:...:....|..| ::.:|          :.:..||...|..:|..:.|.:
  Fly   190 LKEFKYGLWGMPNFLNDSIVTTGVPCFLEMLDK----------VPELTKYKPYFEKIKDNYIQQM 244

  Fly   248 STL------ELNPDEFHVLNHGDFWSSNLMSSYLPD-GTLEKLILIDFQIVMWGSPAMDLLFFLT 305
            |.:      ...|:.::||.||||...|:|..|..: |:.|.::|:||||......::||::.:.
  Fly   245 SAVMEEYRTNPKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIF 309

  Fly   306 LSPTNDLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNHLPI 370
            :....:.|......::..|:..|.:.||.:..|..:|....:...::  .|..|.||.:.:.||:
  Fly   310 MVMDTEDRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIH--GHKDYEFFMMTSFLPL 372

  Fly   371 I 371
            :
  Fly   373 V 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 74/296 (25%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 76/302 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.