DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG14314

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:408 Identity:110/408 - (26%)
Similarity:176/408 - (43%) Gaps:52/408 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FESVLAKDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDGSVKTKTYIFKTMLPE---- 85
            |:.:....||| |::..|.:......|:|:|:.:.|  |||..|..|:|.:..:...::||    
  Fly    31 FQDIFKHVEPD-VQIDAFELAQGSDRGDNYTAALYR--IKLTGKRRSLKWEQNVICKVMPESVVA 92

  Fly    86 -ERGGSDINEFGLFPKEAMMYKTYLP---AFEALYKDVGWDI-QLAPKCLHTEEREGDIHFIFED 145
             |...||    .||..|...|.|.:|   .|:|...:....: ...|||.....   |: .|.||
  Fly    93 REAYKSD----KLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSARH---DL-LIMED 149

  Fly   146 LCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSEF-------SEG-FVKKDV 202
            |..:.|:..||.|||.:|.....|.::|:.|..|..|:   ...|.||       ||| |...:.
  Fly   150 LRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYK---FEKPLEFSNLCSMISEGIFCTANT 211

  Fly   203 KKFHVDGFQLKEKAYKKA--MLSWGLKDADKYIKA---FPTVKQYWAQCLSTLELNPDEFHVLNH 262
            ..:.    ...|:..|.|  |:|..|....||:.|   |.....::.:.:. |.........:.|
  Fly   212 SWYR----NYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAESSSFFGRMVK-LASTESPLSAICH 271

  Fly   263 GDFWSSNLMSSYLPDG---TLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIY 324
            ||.|.:|.:..|.|:.   .|| :.|:|||::.:.|.|:|:...|....|.::|..:....::||
  Fly   272 GDCWVNNFLYHYDPEDPHRVLE-VALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIY 335

  Fly   325 WERLVECLKVLKLKKP-----LPKLRDLQNSMNNKNHSFYAFFSILNHLPIILFPTDKDSNIHNL 384
            .|.|...|::|....|     |.||:|| .:...|.:..:|....|:.|||....::...::: |
  Fly   336 TEELFRWLQMLCTNLPDHCDTLQKLQDL-FAEELKTYGRFALGLALDILPISTCSSEDAPDMY-L 398

  Fly   385 SANTEEGENYRLRLLSNP 402
            ..:.|.||:.....|:.|
  Fly   399 DRSDELGEDVGAPTLNFP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 84/305 (28%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 85/308 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.960

Return to query results.
Submit another query.