DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG6908

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:428 Identity:137/428 - (32%)
Similarity:225/428 - (52%) Gaps:30/428 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DDIVNPNEHLI---IPDWINEKYFESVLAKDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLE 66
            :|:|...|.:.   ||.|::::.||.:|.:|.||..|:..|.:......|||:|:.:||...:||
  Fly    33 NDMVRETEDIAIEPIPAWLDQQKFEPILERDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELE 97

  Fly    67 MKDGSVKTKTYIFKTMLPEERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLH 131
            :.|||.::.:|:.| :||......::..:.:|.||...|..|:|.||.:|||.|..|...|:...
  Fly    98 LNDGSEQSISYMAK-ILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYE 161

  Fly   132 TEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSEFSEG 196
            ::....|...:.|||..:.|:|:||..|||::|....|:|||::||||||..||.|.||.|:::.
  Fly   162 SQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQN 226

  Fly   197 F---------VKKDVKKFHVDGFQLKEKAY-KKAMLSWGLKDADKYIKAFPTVKQYWAQCLSTLE 251
            .         ::::..|.::|.|.|.:.:: ...:.::|.:..|.:....|.::           
  Fly   227 LCSVVDSLKELRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPKIE----------- 280

  Fly   252 LNPDEFHVLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKE 316
               .||.||||||.|.:|:|..|...|.|.::..:|.|:..:.|||.|||:.:..|...|::|.:
  Fly   281 ---GEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAK 342

  Fly   317 FDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNHLPIILFPTDKDSNI 381
            ||:.::.|.|:|:|.||:||..||||.||.|..|:...........|||  ||::|.....|:|:
  Fly   343 FDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSIL--LPLVLIDGGDDANM 405

  Fly   382 HNLSANTEEGENYRLRLLSNPAFGNVMKDLYPFLYNRG 419
            .:|......|:..|..:..|.......|::.|:.:.||
  Fly   406 DSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 94/290 (32%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 98/296 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D27900at6960
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.