DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG6830

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:411 Identity:137/411 - (33%)
Similarity:229/411 - (55%) Gaps:10/411 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IPDWINEKYFESVLAKDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDGSVKTKTYIFK 80
            ||||:|...|:.::...||:..|:|..|...|..||:||.|.:|:|.|:.::||.||||.:||.|
  Fly   482 IPDWLNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILK 546

  Fly    81 TMLPEERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLHTEEREGDIHFIFED 145
              :..:....:.::|.|||||..:|.||:||||..|||||..:..:||.....:.....:.:.|:
  Fly   547 --VHSDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLEN 609

  Fly   146 LCVKRFKNMDRTKGLDMEHMTKC-LQKLAEYHAASAVYEELHGPYPSEFSEGFVKKDVKKFHVDG 209
            |....||.:||..|:|:|| :|| |:|||::||||..|:||:|||..:::.|...:.........
  Fly   610 LQPSGFKMVDRMIGMDLEH-SKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGM 673

  Fly   210 FQLKEKAYKKAMLSWGLKDADKYIKAFPTV-KQYWAQCLSTLELNPDEFHVLNHGDFWSSNLMSS 273
            |...:|::.:.:..:  ...|:|:...|.: ..|..:.|...::|...|:||||||.|.:|:|..
  Fly   674 FVNTKKSFIEEVSKF--DGVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQ 736

  Fly   274 YLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERLVECLKVLKLK 338
            |..||.:::.:|:|.|:..:|:||.||.:|:..|...|:::.:||:.:|.|.:.:.|..|:|...
  Fly   737 YESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYN 801

  Fly   339 KPLPKLRDLQNSMNNKNHSFYAFFSILNHLPIILFPTDKDSNIHNLSANTEEGENYRLRLLSNPA 403
            ..:|.|::|...:  ..|..:|..::|..|.:.|..|..|....:...|.|.|::.|..:.||..
  Fly   802 GFIPSLKELHAIL--IQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSNER 864

  Fly   404 FGNVMKDLYPFLYNRGIL-NF 423
            :...::.:.|::..||:| ||
  Fly   865 YRANIERVMPWINRRGLLDNF 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 100/282 (35%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 103/288 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442526
Domainoid 1 1.000 207 1.000 Domainoid score I6156
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12411
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D27900at6960
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.