DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG9259

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:423 Identity:100/423 - (23%)
Similarity:176/423 - (41%) Gaps:76/423 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EKYFESVLAKDEPDHVKVLKFTV--VAAIPPGENFTSTMLRVYIKLEMKDGSVKTKTYIFKTM-L 83
            ::||...::..:.. ..::.:|:  .:..|.|...:...|.|.:||...: .|:..|:..|:. :
  Fly    17 QRYFHQDVSNSDTG-FDIVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSE-EVRQLTFFSKSAPV 79

  Fly    84 PEERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLHTEEREGDIHFIFEDLCV 148
            ..|.....:.:||:|.||..:|:..||   .|:|...   ::||||.:.::.    ..|||:|..
  Fly    80 GNESRMEYLEDFGVFEKEIAVYQNVLP---DLHKACA---EVAPKCYYADKN----LLIFENLAD 134

  Fly   149 KRFK-NMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHG-----PYPSEFSEGFVKKDVKKFHV 207
            :.:: ...|...|..|.:..||:.||..||.|.:.|:..|     ..|....|.....||...|:
  Fly   135 QGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSDVSPEHM 199

  Fly   208 D--GFQ---LKEKAYKKAMLSWGLKDADKYIKAFPTVKQYWAQCLSTLELNPDEFHVLNHGDFWS 267
            .  .||   |..|.:.|.:..:..| .|..::.|.....:..:.:.|.::..   :.:.|||.|:
  Fly   200 RMVNFQNACLVLKEFIKLIPKYQSK-LDYVLENFTEKMSFIFEAVKTSDVYQ---NTILHGDLWA 260

  Fly   268 SNLMSSYLPDGTLE-KLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERLVEC 331
            :|:|..|...|.:. :..|:|||:..:..|.:|:|..||:..:.:.|.......:..|:..:.|.
  Fly   261 NNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEF 325

  Fly   332 LK--VLKLKKPLPKLRDLQNSMNNKNHSFY----AFFSI-------LNHLPIILFP--------- 374
            ||  .|.:.:.:|:            .:||    .|.|:       ..|| :||.|         
  Fly   326 LKRADLDIARFIPE------------QTFYESVQKFRSVGLIESCLFCHL-VILPPHCTQKLTSS 377

  Fly   375 --------TDKDSNIHNLSANTEEGENYRLRLL 399
                    |:|...|...:.||:  |.||.||:
  Fly   378 VDGFNDFFTNKRIEICLEAFNTD--ELYRSRLV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 72/293 (25%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 72/285 (25%)
APH <252..325 CDD:279908 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459665
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.