DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and F59B1.10

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:342 Identity:64/342 - (18%)
Similarity:120/342 - (35%) Gaps:117/342 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LHTEEREGDIHFIFEDLCVKR--------------------------------------FKNMDR 156
            |.|:|.|..::..||..|.|.                                      |..|:.
 Worm   100 LITKEVEEQMYAYFESSCKKMHNQEMNFYEVAGKFNSKTLLIPKVYFYTKLDEKNSNKGFIGMEY 164

  Fly   157 TKGLDMEHM--TKCLQKLAEYHAASAVYEELHGPYPSEFSEGFVKKDVKKFHVDGFQLKEKAYKK 219
            .:|..:.|.  |..::::.....|.|..:.|....|:|.|     ||::|  :|...:.::..|.
 Worm   165 VEGSIVRHSYDTCTIEEIQPILRAIAKLQALSLQNPAEIS-----KDLQK--IDNGAIFQETLKM 222

  Fly   220 AMLSWGLKDADKYIKAFPTVKQYWAQCLSTLELNPDEF-----------------HVLNHGDFWS 267
            .:...|:|...:..:...  :..:.:.:..:|...:|.                 :||.|||.|:
 Worm   223 MLSESGIKGIFEQCRNLE--RSRFGEKVDRIEEKRNEILDFEKAFNLNKVVGIKQNVLCHGDLWA 285

  Fly   268 SNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERLVE-- 330
            :|.:.:. .:|......::|:|:...|:||.||:..|..:.|...|        :.:|::::|  
 Worm   286 ANFLWTE-NNGVFCATRIVDYQMSHLGNPAEDLVRLLVSTITGADR--------QAHWQQILEQF 341

  Fly   331 ---------------CLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSI--LNHLPIILFPTDKD 378
                           .|:.|||                   ||..:|.:  |..||  ||....|
 Worm   342 YSYFLNELGSGEAPYTLEQLKL-------------------SFKLYFPVGALALLP--LFGPAVD 385

  Fly   379 SNIHNLSANTEEGENYR 395
            :.:..:  ::|:.|..|
 Worm   386 AKLEGM--DSEKAEKCR 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 48/274 (18%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 64/342 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.