DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG5126

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:410 Identity:90/410 - (21%)
Similarity:167/410 - (40%) Gaps:70/410 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ENFTSTMLRVYIKLEMKDGSVKTKTYIFKTMLPEERGGSDINEFGLFPKEAMMYKTYLPAFEALY 116
            :.|.|.:..|.:.:.:.:.. :|:..:.|.|...|......|.:..|..|...|...|||:|.:.
  Fly    41 DGFMSALYTVTLDVVIAERK-RTEVVLVKFMKGTEEFRESSNSYIQFSNEIFAYAEILPAYENVL 104

  Fly   117 KDVGWDIQL----APKCL-----HTE-------------EREGDIHFIFEDLCVKRFKNMDRTKG 159
            :....:.::    .|.|.     |.|             ..:||.:.:...|.::| ..::...|
  Fly   105 RTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGPRLTLRR-DQLEAMVG 168

  Fly   160 L-----DMEHMTKCLQKLAEYHAASAVYEELHGPYPSEFSEGFVKKDV------KKFHVDGFQLK 213
            |     .:.:.||.||........:.|.:.   |:.|...:|..  ||      .:|:....:.|
  Fly   169 LVGPFHALGYATKILQPNVHARLRAGVVDM---PFVSSSGKGIF--DVLYRVAFDRFYEFYDRQK 228

  Fly   214 EKAYKKAMLSWGL---KDADKYIKAFPTVKQYWAQCLSTLELNPD-EFHVLNHGDFWSSNLMSSY 274
            |:..:.|...:|.   :..:||.|. ||:.....:..|..|..|| .|....|||:..:|::..|
  Fly   229 EQLLQGADPGFGAAIERLREKYFKQ-PTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHY 292

  Fly   275 LPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERLVECLKVLKLKK 339
            ..:..::.:..||||.:.:.:.|:||.||:.::..::.|.:.:...:|.|...::|.|: |.|::
  Fly   293 GAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLE-LVLRR 356

  Fly   340 PLPKLRD------LQN------SMNNKNHSFYAFFSILNHLPIILFPTDKD-SNIHNLSANTEEG 391
            ...:|.|      ||.      :.:.|.::||.....::.||.:| .|:|| :.:..|......|
  Fly   357 NRNELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHFLPWLL-GTEKDCAELSRLFETDMHG 420

  Fly   392 ENYRLRLLSNPAFGNVMKDL 411
                      |||..:..|:
  Fly   421 ----------PAFHQLSLDI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 67/315 (21%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 69/320 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.