DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG31974

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:420 Identity:88/420 - (20%)
Similarity:166/420 - (39%) Gaps:88/420 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYFESVLAKDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDGSVK-----------TKT 76
            |....|:....|:...:..::......||:|:.|.||.|..|:...||.::           |..
  Fly     8 KNLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTND 72

  Fly    77 YIFKTMLPEERGGSDINEFGLF----PK--EAMMYKTYLPA--FEALYKDVGWDIQLAPKCLHTE 133
            ..::...||.   :.|.|..::    |:  :..:....|||  |:...:..|..:.|..:....:
  Fly    73 LYWQIFQPER---TCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVD 134

  Fly   134 EREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHA--------ASAVYEELHGPYP 190
            .   |...:.|::..:.::..:|.:..::......|..||:|||        ...||||...|| 
  Fly   135 R---DAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPY- 195

  Fly   191 SEFSEGFVKKDVKKFHVDGFQLKEKAYKKAMLSWGLKDA------DKYIKAFPTVKQYWAQCLST 249
                  |.|.|:.. ::|  |.:.:...|.:    |||.      ::.:.....:...:....::
  Fly   196 ------FKKFDMNS-NID--QAETEIMNKEI----LKDIKLVTSDERDVNRVKELLDIFQAFQAS 247

  Fly   250 LELNPDEFHVLNHGDFWSSNLMSSY---LPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTND 311
            .:::...|..|.|||.|.:|:|..|   ..:||..|:.::||||..:||...|::|.|..|...:
  Fly   248 NDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVN 312

  Fly   312 LRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILN-----HLPII 371
            :....|.:|:.||:...::.|:.:              :::..|:::..|...:.     .||..
  Fly   313 VLEDNFYNFLTIYYNAFIQTLRSV--------------NVDTSNYTYELFLEEVQQTAHVQLPHA 363

  Fly   372 LF------------PTD-KDSNIHNLSANT 388
            :|            |.| ||.:...|:.||
  Fly   364 IFMMKVILADNSTIPKDYKDVDFSVLTKNT 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 72/316 (23%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 73/335 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.