DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG7135

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:420 Identity:106/420 - (25%)
Similarity:177/420 - (42%) Gaps:67/420 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PDWINEKYFESVLAKDEPDH------VKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDGSVKTK 75
            |.::..::|...|     :|      ::|:...:......|||:.|.:.|..||....:......
  Fly     9 PLYLTPQFFRRTL-----EHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMET 68

  Fly    76 TYIFKTMLPEERGGSDINEFGLFPKEAMMYKTYLPAFEAL-YKDV----GWDIQLAPKCLH-TEE 134
            :.|.|:| |:|: .:.:....::.||.:.|....|..||| ::.|    .|  .||||..: |.:
  Fly    69 SLIVKSM-PDEK-QAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAW--TLAPKHYYSTTQ 129

  Fly   135 REGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEE--------------L 185
            .|..|  |.||||...::...|..|||.:|....:.|||||||.:.|..|              |
  Fly   130 PEQTI--ILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLL 192

  Fly   186 H------GPYPSEFSEGFVKKDVKKFHVDGF-QLKEKAYKKAMLSWGLKDADKYIKAFPTVKQYW 243
            |      .|:...|....:|........:|| .:..|.|:     :.....::.:||...::   
  Fly   193 HMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYR-----YHEHFTERVLKAVYPLR--- 249

  Fly   244 AQCLSTLELNPDEFHVLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSP 308
                       ...:||||||.|.:|:...|..:.|::::.:||||:..:||...|:.:||..|.
  Fly   250 -----------GNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSL 303

  Fly   309 TNDLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNHLPII-L 372
            ..::........|.||:..||:|||.|...|.||...|:.:.:  :....|.||......|:: :
  Fly   304 ELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEI--RKREAYGFFVAFGFFPLMSM 366

  Fly   373 FPTD-KDSNIHNLSANTEEGENYRLRLLSN 401
            ...| :|:::.|....|...:..:|....|
  Fly   367 IGVDSEDNSLKNFHDETFARQKVQLMFEGN 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 83/307 (27%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 86/311 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459241
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
87.860

Return to query results.
Submit another query.