DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and CG32195

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:415 Identity:116/415 - (27%)
Similarity:199/415 - (47%) Gaps:41/415 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYFESVLAKDEP-DHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMK-DGSVKTKTYIFKTMLPE 85
            :|||..||:... :.::|..|.:.|....||||.|.:.||.:..... ||::::..||.|.:||.
  Fly     9 EYFERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYILKDLLPA 73

  Fly    86 ERGGSDINEFGLFPKEAMMYKTYLPAFEALY----KDVGWDIQLAPKCLHTEEREGDIHFIFEDL 146
            ..        .|...|..|::..|||.:|:.    |::| :.:|:..||..|...|...:|.|||
  Fly    74 AA--------ALGTNEKDMFEVLLPAMQAILEEAPKEIG-EHKLSADCLLVEISAGKELYILEDL 129

  Fly   147 CVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAV-YEE----LHGPYPSEFSEGFVKKDVKKFH 206
            ....:::.||.:||::|....|::|||::|.||.| ||:    :....||.::.|...:..:...
  Fly   130 GALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLNDRFAQALV 194

  Fly   207 VDGFQLKEKAYKKAMLSWGLKDADKYIKA-FPTVKQYWAQCLSTLELNPDEFHVLNHGDFWSSNL 270
            ::|.:...:|:.:.     |.:..|.:|| .|  |.|..:....::.|....:.:.|||.|.:|:
  Fly   195 LEGAEYAAEAFAEE-----LPEISKKMKAQIP--KAYTKRMRDVVDPNKSSLNAVIHGDPWLNNI 252

  Fly   271 MSSYLPDGTLEKLILIDFQIVMWGSPAMDL--LFFLTLSPTNDLRIKEFDHFVRIYWERLVECLK 333
            |..::.    :|..|:|||...|||||:||  ||:.:|.|  :|.:...|..:..|::.|:|.|:
  Fly   253 MFDFVN----KKATLVDFQNCYWGSPAIDLYFLFYTSLKP--ELLLNNQDELLNYYFDNLLETLR 311

  Fly   334 VLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNHLPIILFPTDK--DSNIHNLSANTEEGENYRL 396
            ....|..||....|::.|  |...||.:::::..|||.....:.  |..:|.. .:|:.....|.
  Fly   312 HCGYKDTLPTFGQLKDEM--KRCLFYGYYTVVCELPICCASPEASVDFGVHTF-VDTDAMLKKRH 373

  Fly   397 RLLSNPAFGNVMKDLYPFLYNRGIL 421
            :|.::......:|.........|||
  Fly   374 QLFASERVRQTIKATLLMFDREGIL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 86/293 (29%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 88/299 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.