DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and E02C12.12

DIOPT Version :10

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:126 Identity:39/126 - (30%)
Similarity:54/126 - (42%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIIPDWIN-EKYFESVLAKDEPDH--VKV---LKFTVVAAIPP--GEN-FTSTMLRVYIKLEMKD 69
            ||.||||: ||      .||.|..  ||:   |...|::.|..  ||| |:...|....|| ::|
 Worm    32 LIEPDWIDVEK------GKDLPKKFAVKISTQLALAVLSKIMKLGGENGFSEEKLNELGKL-IRD 89

  Fly    70 G---SVKTKTYIFKTMLPE--------ERGGSDINEF-GLFPKEAMMYKTYLPAFEALYKD 118
            |   .|.|...:.|...|:        .:|.||.|:. |....|.:.....:|.:||:..|
 Worm    90 GHNREVATYKLLEKMNHPDIPYTKVYGLKGYSDANDLKGFMIMEFIPNVRSIPMYEAILAD 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKL 50..331 CDD:397213 23/84 (27%)
E02C12.12NP_505432.2 Protein Kinases, catalytic domain 1..>200 CDD:473864 39/126 (31%)

Return to query results.
Submit another query.