DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and C29F7.1

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:342 Identity:78/342 - (22%)
Similarity:127/342 - (37%) Gaps:81/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GSDINEFGLFPKEAMMYKTYLPAFEALYKDV---GWDIQLAPKCLHTEEREGD--------IHFI 142
            |.|:|:    ...|.:.:.::...|..|.:|   ..|:.:....::...:.||        :..:
 Worm    87 GVDVNK----GNAAAIMELFMHNTECNYYNVFRKYTDLPMKVPVIYCAAKAGDAEAPVPVIVMEM 147

  Fly   143 FEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSEFSEGFVKKDVKKFHV 207
            |||..|.     |...|.|.:.:.|.:.::...|..|...||.....|..     ..:|.    |
 Worm   148 FEDCTVH-----DLIDGFDKDQLFKIVDEIVNLHIFSLTTEEWRSVLPDS-----AMRDT----V 198

  Fly   208 DGFQLKEKAYKKAML-SWGLKDADKYIKAFPTVKQYWAQCLSTLELNP-------DEF------H 258
            |.|:...|...:.|. |.||:...|||:             .|.:.:|       ||:      .
 Worm   199 DLFEAMVKTIAENMAKSPGLEIISKYIE-------------KTFDKDPSFMTKFSDEYLEGKRKS 250

  Fly   259 VLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPT----NDLRIKEFDH 319
            ||.|||.||..::  :..|..:..  :||:|:...|||..||...|:...:    |.|.....||
 Worm   251 VLTHGDLWSPQIL--WDKDDNIAG--IIDWQVGHQGSPMEDLHRILSTGTSVENRNKLTKPLLDH 311

  Fly   320 FVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSF-----YAFFS--ILNHLPIILFPTDK 377
                |:|:|...|:...:|.|..:    :......||.|     ...||  |.:..||:  .||.
 Worm   312 ----YFEKLSAGLEEKGVKMPWTR----EEVDEEYNHCFSYGASITIFSNGIWSSSPIL--QTDG 366

  Fly   378 DSNIHNLSANTEEGENY 394
            ..:...:|.:....::|
 Worm   367 KPDPARISESFARCQSY 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 63/270 (23%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 54/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.