DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31288 and F59B1.8

DIOPT Version :9

Sequence 1:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:329 Identity:65/329 - (19%)
Similarity:118/329 - (35%) Gaps:79/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LAPKCLHTEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEH---------MTKCLQKLAEYHAASA 180
            |.||...:::.|       ||...|.|..|:..:|..:.|         :...|:.||...|.|.
 Worm   138 LLPKVFFSQKFE-------EDNPNKGFVGMEFVEGSVVRHCYENVTVDELQPILKALARLQALSL 195

  Fly   181 VYEELHGPYPSEFSEGFVKKDVKKFHVDGFQLKEKAYKKAMLSWGLKDADKYIKAFPTVKQYWAQ 245
            ..|....   .:..|.|.:..:.....||.:             |:.|..:      .:.|..::
 Worm   196 STESCRN---LDNGEAFEESLMDMLSEDGLK-------------GIFDQSR------NIDQKLSE 238

  Fly   246 CLSTLELNPDEF----HVLN-------------HGDFWSSNLMSSYLPDGTLEKLILIDFQIVMW 293
            .:..:|.|..|.    .|||             |||.|::|::.:....|.:...:| |:|....
 Worm   239 KVERIEQNHKEILNLETVLNLNKVVGIDQKVICHGDLWAANILWTQTDGGFIADKVL-DYQESHM 302

  Fly   294 GSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSF 358
            |:||.||:..|..:.:...|...::|.:..::....:.:........|.:|:.          ||
 Worm   303 GNPAEDLVRLLVSTISGADRQSHWEHILEQFYTYFTDEIGSNNAPYTLEQLKT----------SF 357

  Fly   359 YAFFSILNHLPIILFPTDKDSNIHNLSANTEEGENYRLRLLSNPAFGNVMKDLYPFLYNRGILNF 423
            ..:|.:.....|.||....|..:..:.:.  :.||||..::...   :.:.|        .:|||
 Worm   358 KLYFPVGALTLISLFGPAVDMKLQGMESG--KAENYRRIVIEKV---DCLLD--------DVLNF 409

  Fly   424 EDYD 427
            .|::
 Worm   410 HDFN 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 47/231 (20%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 65/329 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.