DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31286 and scl-11

DIOPT Version :10

Sequence 1:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_502499.1 Gene:scl-11 / 186050 WormBaseID:WBGene00009892 Length:207 Species:Caenorhabditis elegans


Alignment Length:40 Identity:14/40 - (35%)
Similarity:19/40 - (47%) Gaps:6/40 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TAMIWRSSVSLGYGDANI-----NALQGVFVV-RYTPPGN 152
            |.|.|.::.::|.|..|.     |....|.|| :|..|||
 Worm   139 TQMAWANTFAIGCGVKNCGKDPSNGYNKVAVVCQYKTPGN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31286NP_731103.1 CAP_GAPR1-like 32..153 CDD:349401 14/40 (35%)
scl-11NP_502499.1 SCP 21..173 CDD:214553 10/33 (30%)

Return to query results.
Submit another query.