DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12121 and TMEM87B

DIOPT Version :9

Sequence 1:NP_572545.1 Gene:CG12121 / 31866 FlyBaseID:FBgn0030109 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001316843.1 Gene:TMEM87B / 84910 HGNCID:25913 Length:555 Species:Homo sapiens


Alignment Length:351 Identity:68/351 - (19%)
Similarity:148/351 - (42%) Gaps:32/351 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 RETINNVHYYSFNFSMMVATPSDEGLYNLYFHACPNYHTSKIMSFNVDIEENNNGNYLSAGEMPL 428
            :|.||..:..:...||.|...:.:..::::..:....:|....:.||.:.......|:||.:.||
Human   152 KELINIRNVSNQERSMDVVARTQKDGFHIFIVSIKTENTDASWNLNVSLSMIGPHGYISASDWPL 216

  Fly   429 PALYFMMSLLFFLSGLFWVFILKKSKHTVYKIHYLMAVLVFLKSL-SLMFHSINYHFIEKRGEHV 492
            ...|.:|.:::.|.|:.|:.........:.:|.:.:|.::||..| ..:|:| .|..|...|...
Human   217 MIFYMVMCIVYILYGILWLTWSACYWKDILRIQFWIAAVIFLGMLEKAVFYS-EYQNISNTGLST 280

  Fly   493 ETWAILYYIAHLLKGAVLFITIVLIGTGWTFIKHILSDKDKKIF---MIVIPLQVLANVAQIITD 554
            :...|...:...:|..:..:.::::..|:..:|..|.....::.   ::.:....:..|.::|  
Human   281 QGLLIFAELISAIKRTLARLLVIIVSLGYGIVKPRLGTVMHRVIGLGLLYLIFAAVEGVMRVI-- 343

  Fly   555 ESDQSDAEFRTWHNI-FFFVDLLCCGAILFPIVWSIRHLHEASATDGKAAINLRKLKLFRQFYIM 618
              ..||::.....:: ...:|...|..|...:..:::.|        :...|..|..|:|.|...
Human   344 --GVSDSDLVLLASLPLSLLDSGLCWWIFISLAQTMKTL--------RLRKNTVKFSLYRHFKNT 398

  Fly   619 IVCYIYFTRIIVDLLQMTVVFQYA---------WLDEMFREMATYVFFVLTGYKFRP-VSSHPYF 673
            ::..:..:  ||.:...|..|:.|         |:|:.|......:..::..:.:|| .::..|.
Human   399 LIFAVLAS--IVFMGWTTKTFRIAKCQSDWMERWVDDAFWSFLFSLILIVIMFLWRPSANNQRYA 461

  Fly   674 TVPDEDEDDDEVE--VLTESGLTETV 697
            .:|..|:.|||:|  ::|...|||.:
Human   462 FMPLIDDSDDEIEEFMVTSENLTEGI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12121NP_572545.1 Spore_coat_CotO 194..>290 CDD:290858
Neuromodulin 195..353 CDD:284117
Lung_7-TM_R 387..671 CDD:284280 51/298 (17%)
TMEM87BNP_001316843.1 Lung_7-TM_R 174..458 CDD:284280 51/298 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.