DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12121 and CG17660

DIOPT Version :9

Sequence 1:NP_572545.1 Gene:CG12121 / 31866 FlyBaseID:FBgn0030109 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_608612.3 Gene:CG17660 / 33347 FlyBaseID:FBgn0031356 Length:536 Species:Drosophila melanogaster


Alignment Length:347 Identity:63/347 - (18%)
Similarity:139/347 - (40%) Gaps:43/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 VATPSDEGLYNLYFH--ACPNYHTSKIMSFNVDIEENNNGNYLSAGEMPLPALYFMMSLLFFLSG 443
            :|:..::|:|.:..:  |.|:...|.:    |.||......::||.:.|....|.:|.:::.:.|
  Fly   156 IASVKEDGIYEIEVNIAAGPSAQFSAV----VHIEFLGPHGFISAIDWPFLPFYLIMCIVYVIFG 216

  Fly   444 LFWVFILKKSKHTVYKIHYLMAVLVFLKSLSLMFHSINYHFIEKRGEHVETWAILYYIAHLLKGA 508
            :.|:|:.......:.:|.:.:..::.|..|...|....|..:..:|..|:...::.......|..
  Fly   217 IIWLFVSFAQWRDLLRIQFWIGGVILLGMLEKAFFYAEYQTLTNKGVAVQHAELVAEFVSCAKRT 281

  Fly   509 VLFITIVLIGTGWTFIKHILSDKDKKI------FMIVIPLQVLANVAQIITDESDQSDAEFRTWH 567
            :..:.::::..|:..:|..|.....::      :.::..::....:..:.||.|:...|...   
  Fly   282 LARMLVIIMSLGFGIVKPRLGPMLHRVVGVGTLYFVLACVESYLRITNVKTDRSELLVASIP--- 343

  Fly   568 NIFFFVDLLCCGAILFPIVWSIRHLHEASATDGKAAINLRKLKLFRQF-------YIMIVCYIYF 625
              ...:|...|..|...:|.:.|.|        :...|:.||.|:|.|       .|..|.::.|
  Fly   344 --LAVLDTGICWWIFTSLVQTTRTL--------RLRRNMVKLSLYRHFTNTLIFAVIASVIFMLF 398

  Fly   626 TRIIVDLLQMTVVFQYAWLDEMFREMATYVFFVLTGYKFRPVSSH------PYFTVPDEDEDDDE 684
            ...:..:...|..::..|:|..|..:...|..::....:||.:::      |....|::::|:||
  Fly   399 ALRLRRVENCTPGWRDIWVDTGFWHILFSVLLLVIMILWRPTNNNQRYAFTPLLDNPEDEDDEDE 463

  Fly   685 VEVLTESGLTETVHRVKQLNRN 706
                 |.......:.||...:|
  Fly   464 -----EDQFVADAYGVKMRGQN 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12121NP_572545.1 Spore_coat_CotO 194..>290 CDD:290858
Neuromodulin 195..353 CDD:284117
Lung_7-TM_R 387..671 CDD:284280 53/304 (17%)
CG17660NP_608612.3 Lung_7-TM_R 160..444 CDD:284280 53/300 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.