DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and ALD5

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_010996.2 Gene:ALD5 / 856804 SGDID:S000000875 Length:520 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:31/165 - (18%)
Similarity:64/165 - (38%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SGNI---SISSCPS-EDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLDLS-HNDFR 122
            ||.:   .:|:.|. :.::|:.|.......:.:|.:.:|.:...|..| :....|.|.. ....:
Yeast   245 SGRVVGERLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGK-SPNIVFADADLDKAVK 308

  Fly   123 NLRFLSFFEDLDTLILDRNVNLDINTF--------PYLPSLRILWINNCDI---ANITD-WIHRI 175
            |:.|..|:...:.......:.:....:        .|..||::....:.::   |..:| .:|:|
Yeast   309 NIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYTESLKVGDPFDEEVFQGAQTSDKQLHKI 373

  Fly   176 ERHCPALDQLSCMGNPGIRTVFGG--QGPREYILQ 208
                  ||.:....:.|.|.|.||  .|.:.|.::
Yeast   374 ------LDYVDVAKSEGARLVTGGARHGSKGYFVK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 5/21 (24%)
leucine-rich repeat 133..154 CDD:275378 1/28 (4%)
leucine-rich repeat 155..181 CDD:275378 5/29 (17%)
ALD5NP_010996.2 ALDH_F1-2_Ald2-like 41..513 CDD:143410 31/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.