DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and LEA1

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_015111.1 Gene:LEA1 / 855888 SGDID:S000006134 Length:238 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:57/232 - (24%)
Similarity:96/232 - (41%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FSGNISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRF 126
            |:|..::..|         .||.|   :.|..:: :::|..| ......|..|||::||...:..
Yeast    19 FNGKYNVDKC---------VILRD---LQLETDS-ESMPSSL-KHLTKPTHILDLTNNDLIMIPD 69

  Fly   127 LSFFEDLDTLILDRN--VNLDINTFPYLPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMG 189
            ||..:|:.||:|.||  |.:|....|.  :::.|.::|..|....| :.|:.|....|..|:.:|
Yeast    70 LSRRDDIHTLLLGRNNIVEVDGRLLPM--NVQNLTLSNNSIRRFED-LQRLRRAPRTLKNLTLIG 131

  Fly   190 NPGIRTVFGGQGPREYILQVLPQLKYLD---GLPTSRNAAYATLSSSQGQ--GPDSTS------- 242
            |    .|......||::|:::|.|:.||   .....|.:|.:....:.|.  ||.:|:       
Yeast   132 N----QVCHLANYREHVLRLVPHLETLDFQNVTAEERKSAMSFPRQADGDTLGPVNTAIRDNGSR 192

  Fly   243 -------------------NSEKPPLASAFTFKDIIR 260
                               |..|..||.|.:.::|.|
Yeast   193 DKTMEIMNLVVSKMTVERRNELKKQLAEATSLEEIAR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 8/20 (40%)
leucine-rich repeat 133..154 CDD:275378 8/22 (36%)
leucine-rich repeat 155..181 CDD:275378 6/25 (24%)
LEA1NP_015111.1 LRR 12..>237 CDD:227223 57/232 (25%)
leucine-rich repeat 54..75 CDD:275378 8/20 (40%)
leucine-rich repeat 76..97 CDD:275378 8/22 (36%)
leucine-rich repeat 98..116 CDD:275378 4/18 (22%)
leucine-rich repeat 117..150 CDD:275378 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.