Sequence 1: | NP_732186.1 | Gene: | CG31274 / 318655 | FlyBaseID: | FBgn0051274 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015111.1 | Gene: | LEA1 / 855888 | SGDID: | S000006134 | Length: | 238 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 232 | Identity: | 57/232 - (24%) |
---|---|---|---|
Similarity: | 96/232 - (41%) | Gaps: | 54/232 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 FSGNISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRF 126
Fly 127 LSFFEDLDTLILDRN--VNLDINTFPYLPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMG 189
Fly 190 NPGIRTVFGGQGPREYILQVLPQLKYLD---GLPTSRNAAYATLSSSQGQ--GPDSTS------- 242
Fly 243 -------------------NSEKPPLASAFTFKDIIR 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31274 | NP_732186.1 | leucine-rich repeat | 111..132 | CDD:275378 | 8/20 (40%) |
leucine-rich repeat | 133..154 | CDD:275378 | 8/22 (36%) | ||
leucine-rich repeat | 155..181 | CDD:275378 | 6/25 (24%) | ||
LEA1 | NP_015111.1 | LRR | 12..>237 | CDD:227223 | 57/232 (25%) |
leucine-rich repeat | 54..75 | CDD:275378 | 8/20 (40%) | ||
leucine-rich repeat | 76..97 | CDD:275378 | 8/22 (36%) | ||
leucine-rich repeat | 98..116 | CDD:275378 | 4/18 (22%) | ||
leucine-rich repeat | 117..150 | CDD:275378 | 9/36 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C157343640 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |