Sequence 1: | NP_732186.1 | Gene: | CG31274 / 318655 | FlyBaseID: | FBgn0051274 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_733936.1 | Gene: | ALDH5A1 / 7915 | HGNCID: | 408 | Length: | 548 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 35/198 - (17%) |
---|---|---|---|
Similarity: | 54/198 - (27%) | Gaps: | 85/198 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 STSERS------------NSED----------SPLNPCLTEVLRNCANIQSL-ESLNYEYNDV-- 44
Fly 45 --------LLTEDNVGKMITPNPYSFS--------GNISISSC-----PSEDVSFSESILEDNGR 88
Fly 89 ISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFLSFFEDLDTLILDRNVNLDINTFPYLP 153
Fly 154 SLR 156 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31274 | NP_732186.1 | leucine-rich repeat | 111..132 | CDD:275378 | 1/20 (5%) |
leucine-rich repeat | 133..154 | CDD:275378 | 4/20 (20%) | ||
leucine-rich repeat | 155..181 | CDD:275378 | 1/2 (50%) | ||
ALDH5A1 | NP_733936.1 | SSADH | 78..541 | CDD:188167 | 35/198 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |