DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and Aldh1l1

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_071992.2 Gene:Aldh1l1 / 64392 RGDID:621294 Length:902 Species:Rattus norvegicus


Alignment Length:261 Identity:56/261 - (21%)
Similarity:95/261 - (36%) Gaps:68/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VGKMITPNP----YSFSGNISI-----SSCPSEDVSFSESILEDNGRISLAY----ENLKTIPRR 102
            ||:.::.:|    ..|:|:..:     .||...:|  .:..||..|:..|..    :..|.:...
  Rat   633 VGQRLSDHPDVRKIGFTGSTEVGKHIMKSCALSNV--KKVSLELGGKSPLIIFADCDLNKAVQMG 695

  Fly   103 LADKF--------AAQTKFLDLS-HNDFRNLRFLSFFEDLDTLILDRNVNLDINTFPYLPSLRIL 158
            ::..|        ||...|::.| ||.|    .....|:::.:.:...:..|.|..|        
  Rat   696 MSSVFFNKGENCIAAGRLFVEESIHNQF----VQKVVEEVEKMKIGNPLERDTNHGP-------- 748

  Fly   159 WINNCDIANITDWIHRIERHCPALDQLSCMGN----PGI---RTVFGGQGPREYILQ------VL 210
              .|.: |::...:...:|.......|.|.||    ||.   .|||.......||.:      ::
  Rat   749 --QNHE-AHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVEDHMYIAKEESFGPIM 810

  Fly   211 PQLKYLDGLPTSRNAAYATLSSSQGQGPDSTSNSEKPPLASAFTFKDIIRPKY-SRKSHSGRMFG 274
            ...::.||      ...|.|         |.:|:.:..|||....:||.:..| |.|..:|.:|.
  Rat   811 IISRFADG------DVDAVL---------SRANATEFGLASGVFTRDINKALYVSDKLQAGTVFI 860

  Fly   275 N 275
            |
  Rat   861 N 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 5/21 (24%)
leucine-rich repeat 133..154 CDD:275378 3/20 (15%)
leucine-rich repeat 155..181 CDD:275378 3/25 (12%)
Aldh1l1NP_071992.2 GART 1..203
Substrate binding. /evidence=ECO:0000250 88..90
Aldehyde dehydrogenase 417..902 56/261 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.