DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and lrmda

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001018537.1 Gene:lrmda / 553730 ZFINID:ZDB-GENE-050522-285 Length:234 Species:Danio rerio


Alignment Length:217 Identity:58/217 - (26%)
Similarity:96/217 - (44%) Gaps:30/217 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VSFSESILEDNG-RISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFLSFFEDLDTLILD 139
            ::.:||::..|| ::|....:.:.||..|..|:....:.||||.|..|:|..|..|..|:.||:|
Zfish     1 MAHNESMVVVNGSQVSCIGHDWEDIPDFLGTKYGQMARRLDLSFNQLRSLTGLKAFSQLEELIVD 65

  Fly   140 RNVNLDINTFPYLPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGNPGIRTVFGG----- 199
            .|:..:....|.||.|..|.:|...:.:|...:..:....|||:.||.:||.........     
Zfish    66 NNLLGNDLRLPRLPRLHTLTLNKNQLTDIEALLEHLVEVTPALEYLSLLGNEACPNQLVSMDKDE 130

  Fly   200 ---QGPREYILQVLPQLKYLDGLPTSRNAAYATLSSSQGQG-----------PDSTSNSEKPPLA 250
               |..|.::|..|..||:||    :|.......|.:|.:|           .|:.|::....:|
Zfish   131 DDYQRYRYFVLHKLTNLKFLD----TRRVTQWERSEAQARGAFMKVVKPKNDQDTASDTRSESIA 191

  Fly   251 SAFTFKDIIRPKYSR--KSHSG 270
            :.:|    ..|:.||  ::|.|
Zfish   192 TPYT----PLPRGSRDARNHKG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 9/20 (45%)
leucine-rich repeat 133..154 CDD:275378 7/20 (35%)
leucine-rich repeat 155..181 CDD:275378 4/25 (16%)
lrmdaNP_001018537.1 leucine-rich repeat 38..58 CDD:275378 9/19 (47%)
LRR_9 <40..164 CDD:317038 38/127 (30%)
leucine-rich repeat 59..80 CDD:275378 7/20 (35%)
leucine-rich repeat 81..107 CDD:275378 4/25 (16%)
leucine-rich repeat 108..146 CDD:275378 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.