DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and aldh16a1

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001073423.2 Gene:aldh16a1 / 492710 ZFINID:ZDB-GENE-070112-2062 Length:795 Species:Danio rerio


Alignment Length:176 Identity:38/176 - (21%)
Similarity:67/176 - (38%) Gaps:55/176 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 EDLDTLILDRNVNLDINTFPYLPSLRILWINNC--------------DIANITD----WIHRIER 177
            ||| ||.|:...:|.:.:         :|: ||              |..|.||    .:::..|
Zfish   419 EDL-TLALESAKSLCVGS---------VWV-NCHSVMDPALPLCGRRDSGNCTDGGREGLYQF
LR 472

  Fly   178 HCPALDQLSCMGNP-GIRTVFGGQGPREYILQVLPQLKYLDGLPTSRNAAYATLSSSQGQGPDS- 240
              |:|.......:| .:.....|..|.::   ::|::  .|  |:|....|:.|...|.:..|| 
Zfish   473 --PSLSPSLPRSSPSSVNYADFGSAPSKF---MIPEV--FD--PSSVPRFYSQLVGGQMRKADSG 528

  Fly   241 TSNSEKPPLASAFTF------KDI---------IRPKYSRKSHSGR 271
            :|.|...|..:....      ||:         ::|.:.:||.:.|
Zfish   529 SSRSVLAPGGAVLAHCPDGGRKDVRNAVEAANKVQPGWMKKSPAAR 574

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity