powered by:
Protein Alignment CG31274 and aldh3a2a
DIOPT Version :9
Sequence 1: | NP_732186.1 |
Gene: | CG31274 / 318655 |
FlyBaseID: | FBgn0051274 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_997814.1 |
Gene: | aldh3a2a / 323653 |
ZFINID: | ZDB-GENE-040718-74 |
Length: | 488 |
Species: | Danio rerio |
Alignment Length: | 47 |
Identity: | 11/47 - (23%) |
Similarity: | 16/47 - (34%) |
Gaps: | 9/47 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 DVLLTEDNVGKMITPNPYSFSGNISISSCPSEDVSFSESILEDNGRI 89
|.:|.|.::...:.. .|..|..|..:......||.|||
Zfish 247 DYILCESSIQDRVID---------EIQKCIKEFYTIDPKTFEDYGRI 284
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1012 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.