DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and CG15717

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster


Alignment Length:160 Identity:34/160 - (21%)
Similarity:51/160 - (31%) Gaps:59/160 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSNSEDSPLNPCLTEVLRNCANIQSL-------ESLNYEYNDVLL-------------------- 46
            |..|::...:|..|..|   |.|:.|       |||....:.||:                    
  Fly    95 RPLSQEVSKHPSYTSTL---AKIEELKAKTVQGESLKAGESPVLVYDCVHSYLGNGATGVVTVHT 156

  Fly    47 --TEDNVGKMITPNPYSFSGNIS------------ISSCPSEDVSFS----------ESILEDNG 87
              |....|::...:|..: |.:|            |...||:.|:.:          ||...|..
  Fly   157 FRTAKEAGQLAKRDPLPY-GQVSLWNEKLGCAYELIPRLPSDIVAINCFNPDLDPIWESFAADRN 220

  Fly    88 RISLA----YENLKTIPRRLADKFAAQTKF 113
            .:.||    ||:|....:|....|...|.|
  Fly   221 DVLLAKNYHYESLVVSGKRRIVVFPVGTIF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 2/3 (67%)
leucine-rich repeat 133..154 CDD:275378
leucine-rich repeat 155..181 CDD:275378
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 33/158 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.