DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and Aldh1l2

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001178707.2 Gene:Aldh1l2 / 299699 RGDID:1309458 Length:923 Species:Rattus norvegicus


Alignment Length:146 Identity:30/146 - (20%)
Similarity:50/146 - (34%) Gaps:46/146 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NYEYNDVLLTEDNVGKMITPNPYSFSGNISISSCPSEDVSFSESILEDNGRISLAYENLKTIP-- 100
            |.::.|        ||||..:.|..||..|:....:|::..:|:|.....||      |..:|  
  Rat   312 NLQFED--------GKMIPASQYFSSGETSVVELTAEELKVAETIKVIWARI------LSNVPVI 362

  Fly   101 ----------------RRLADKFAAQTKFLDLSHNDFRNLRFLSFF----------EDLDTLILD 139
                            .||.::...:...|.|.:.|....|....|          ||.:..::.
  Rat   363 EDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMARKFGDFIQKVVRRLRGEDQEAELVV 427

  Fly   140 RNVNLDIN----TFPY 151
            ..|:.::|    ..||
  Rat   428 DYVSKEVNEMTVKMPY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 5/30 (17%)
leucine-rich repeat 133..154 CDD:275378 4/23 (17%)
leucine-rich repeat 155..181 CDD:275378
Aldh1l2NP_001178707.2 FMT_core_FDH_N 23..225 CDD:187716
FDH_Hydrolase_C 228..327 CDD:187731 6/22 (27%)
PP-binding 346..>390 CDD:395435 8/49 (16%)
ALDH_F1L_FTFDH 438..923 CDD:143458 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.