DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and ALDH3A2

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001026976.1 Gene:ALDH3A2 / 224 HGNCID:403 Length:508 Species:Homo sapiens


Alignment Length:66 Identity:15/66 - (22%)
Similarity:24/66 - (36%) Gaps:14/66 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IQSLESLNYEYNDVLLTEDNVGKMITPNPYSFSGNISISSCPSEDVSFSESILEDNGRISLAYEN 95
            :|.||:|.              :|:..........|:...|.||...:|:.::...|.|....||
Human    24 LQQLEALR--------------RMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLEN 74

  Fly    96 L 96
            |
Human    75 L 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378
leucine-rich repeat 133..154 CDD:275378
leucine-rich repeat 155..181 CDD:275378
ALDH3A2NP_001026976.1 ALDH_F3AB 5..444 CDD:143450 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.