DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and Aldh1a2

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_033048.2 Gene:Aldh1a2 / 19378 MGIID:107928 Length:518 Species:Mus musculus


Alignment Length:168 Identity:34/168 - (20%)
Similarity:43/168 - (25%) Gaps:94/168 - (55%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 RLADKFAAQTKFLDLSHNDFRNLR----------FL-SFFEDLDTLI---------------LDR 140
            ||.||.|      ||...|...|.          || :|:.||..:|               :..
Mouse   104 RLLDKLA------DLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTI 162

  Fly   141 NVNLDINTF-------------PY-LPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGN- 190
            .|:.|..||             |: .|.|...|                 :..|||    |.|| 
Mouse   163 PVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTW-----------------KIAPAL----CCGNT 206

  Fly   191 --------------------------PGIRTVFGGQGP 202
                                      ||:..:..|.||
Mouse   207 VVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 7/31 (23%)
leucine-rich repeat 133..154 CDD:275378 7/49 (14%)
leucine-rich repeat 155..181 CDD:275378 2/25 (8%)
Aldh1a2NP_033048.2 ALDH_F1AB_F2_RALDH1 32..512 CDD:143459 34/168 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.