DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31274 and ALDH1L1

DIOPT Version :9

Sequence 1:	NP_732186.1	Gene:	CG31274 / 318655	FlyBaseID:	FBgn0051274	Length:	280	Species:	Drosophila melanogaster
Sequence 2:	NP_001257293.1	Gene:	ALDH1L1 / 10840	HGNCID:	3978	Length:	912	Species:	Homo sapiens

Alignment Length:	114	Identity:	29/114 - (25%)
Similarity:	42/114 - (36%)	Gaps:	21/114 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    56 TPNPYSFSGNISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHND 120
            |.||...|....:|.....||..:.:..:|      |:||.:.......|:.....:..||..
Human   451 TINPTDGSVICQVSLAQVTDVDKAVAAAKD------AFENGRWGKISARDRGRLMYRLADLME-- 507

  Fly   121 FRNLRFLSFFEDLD-----TLILDRNVNLDINTFPYLPSLRILWINNCD 164
             ::...|:..|.||     ||.|..:|.:.|.||.|...    |   ||
Human   508 -QHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAG----W---CD 548

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31274	NP_732186.1	leucine-rich repeat	111..132	CDD:275378	3/20 (15%)
		leucine-rich repeat	133..154	CDD:275378	10/25 (40%)
		leucine-rich repeat	155..181	CDD:275378	3/10 (30%)
ALDH1L1	NP_001257293.1	Fmt	10..319	CDD:223301
		FMT_core_FDH_N	11..213	CDD:187716
		FDH_Hydrolase_C	216..316	CDD:187731
		PP-binding	335..401	CDD:278949
		ALDH_F1L_FTFDH	427..912	CDD:143458	29/114 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1012
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900