DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31274 and LOC100331330

DIOPT Version :9

Sequence 1:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017212633.1 Gene:LOC100331330 / 100331330 -ID:- Length:202 Species:Danio rerio


Alignment Length:175 Identity:53/175 - (30%)
Similarity:77/175 - (44%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PYSFSGNISISSCPSEDVSFSESILEDNG--------RISLAYENLKTIPRRLADKFAAQTKFLD 115
            |:|:      ::..:||:..........|        |:|.||::|..||.....|.....:.||
Zfish     2 PWSW------AAAAAEDIDMESGPSTPAGPAVELGLRRLSFAYQDLLEIPYDTILKQQDSLEVLD 60

  Fly   116 LSHNDF-RNLRFLSFFEDLDTLILDRNVNLDINT-FPYLPSLRILWINNCDIANITDWIHRIERH 178
            ||:|.. .|...|...|.|.|||||.| |...:. ||::|||..||||...|:|:...:..|...
Zfish    61 LSYNLLEENPALLGGLEKLSTLILDCN-NYSAHVKFPFMPSLTTLWINKNKISNLPIIVEEICCK 124

  Fly   179 CPALDQLSCMGNPGIRTVFGGQG------PREYILQVLPQLKYLD 217
            .|.:..||.|.|....:.|.|..      .|:|::..:..|:.||
Zfish   125 FPNIKILSMMNNEAAPSYFNGGSLTQYIDYRQYVISQILGLEVLD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 7/21 (33%)
leucine-rich repeat 133..154 CDD:275378 10/21 (48%)
leucine-rich repeat 155..181 CDD:275378 8/25 (32%)
LOC100331330XP_017212633.1 LRR_8 30..88 CDD:290566 23/58 (40%)
leucine-rich repeat 31..55 CDD:275380 8/23 (35%)
leucine-rich repeat 56..78 CDD:275380 7/21 (33%)
LRR_9 <76..189 CDD:258718 33/95 (35%)
leucine-rich repeat 79..100 CDD:275380 10/21 (48%)
leucine-rich repeat 101..127 CDD:275380 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0015150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110427
Panther 1 1.100 - - LDO PTHR46282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.