DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and PROZ

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_016876301.1 Gene:PROZ / 8858 HGNCID:9460 Length:467 Species:Homo sapiens


Alignment Length:161 Identity:49/161 - (30%)
Similarity:69/161 - (42%) Gaps:35/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PYQISLQGISGAHSCGGAIINETFVLTAAHCV---ENAFIPWLVVVTGTNKYNQPGGRYFLKAIH 111
            |:|:.|....|...|||.||.|.||||.|.|.   .|     :.|.|..|:.:|......:..:|
Human   256 PWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRN-----ITVKTYFNRTSQDPLMIKITHVH 315

  Fly   112 IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP--------LVPMQPGDEVILTGW------- 161
            :|..||.....||::||||..||.......|:..|        |:|...|   :|:||       
Human   316 VHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRG---LLSGWARNGTDL 377

  Fly   162 GSTVLWGTSPIDLQVLYLQYVPHRECKALLS 192
            |:::.  |.|:.|       |...||..:|:
Human   378 GNSLT--TRPVTL-------VEGEECGQVLN 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 49/161 (30%)
Tryp_SPc 38..258 CDD:238113 49/161 (30%)
PROZXP_016876301.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7840
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.