DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and f7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:252 Identity:74/252 - (29%)
Similarity:117/252 - (46%) Gaps:39/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV----ENAFIPWLVVVTG 94
            |..||:||.....|..|:|..|. .:....|||.:|...:|:|||||:    ||.    |.||.|
 Frog   208 KRARIVGGDMCPKGECPWQALLM-YNEIFICGGTLIAPNWVITAAHCLKPLPENK----LTVVLG 267

  Fly    95 TNKYNQPGG---RYFLKAIHIHCNYDNPEMH--NDIALLELVEPIAWDERTQPIPLP-------- 146
            .::...|.|   ...:..|.:|.:|...:.:  ||||||:|..|:.:.:...|:.||        
 Frog   268 EHRIGTPEGTEQESKVSKIIMHEHYYGSKTNNDNDIALLKLTTPVNYTDYVVPLCLPEKQFAVQE 332

  Fly   147 LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC----KALLSNDEDCDVGHICTFSR 207
            |:.::..   .::|||..:..|.:|..||.:.|..|..::|    :..:|.:..|     ..::.
 Frog   333 LLSIRYS---TVSGWGRLLESGATPELLQRVQLPRVKTQDCIRQTQMNISQNMFC-----AGYTD 389

  Fly   208 LGEGACHGDSGGP----LVSNGYLVGLVNWGWPCATGVP-DVHASVYFYRDWIRNVM 259
            ..:.:|.||||||    ..:..:|.|:|:||..||.... .|:..|..|.:||:..|
 Frog   390 GSKDSCKGDSGGPHATQYKNTHFLTGIVSWGLGCAKKEKYGVYTRVSRYTEWIKENM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/243 (29%)
Tryp_SPc 38..258 CDD:238113 71/245 (29%)
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011
FXa_inhibition 153..189 CDD:373209
Tryp_SPc 212..445 CDD:238113 71/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.