DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss36

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:270 Identity:84/270 - (31%)
Similarity:118/270 - (43%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRFYKDQRIIGGQAAEDGFAPYQISL-QGISGAHSCGGAIINETFVLTAAHC-VENAFI---PWL 89
            ||.....||:||..|..|..|:|:|| ||  |.|.|||::|..::||:|||| |.|..:   ..|
Mouse    40 GRPEPSSRIVGGSDAHPGTWPWQVSLHQG--GGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEL 102

  Fly    90 VVVTGTNKYNQPGGRYFLKAIHIHC--------NYDNPEMHNDIALLELVEPIAWDERTQPIPLP 146
            .|:.|.:..:.|     |:..|:..        ||...|:..|:|||.|..|.......:|:.||
Mouse   103 SVLLGVHSQDGP-----LEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLP 162

  Fly   147 LVP--MQPGDEVILTGWGSTVLWGTSPID--LQVLYLQYVPHRECKALLSNDEDCDV------GH 201
            ...  ...|.....||||........|:.  ||.:.|:.:....|:.|.|.....::      |.
Mouse   163 RASHLFAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGM 227

  Fly   202 ICTFSRLG-EGACHGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMS 260
            :|.....| ...|.||||||||    ...:|.|:.::|:.|. ...|.|..:|..|..|||..:.
Mouse   228 LCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWIREHVM 292

  Fly   261 GNSKCTGFSS 270
            |:.....|.|
Mouse   293 GSEPGPVFPS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/246 (31%)
Tryp_SPc 38..258 CDD:238113 78/248 (31%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 78/248 (31%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.