DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and zgc:153968

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:273 Identity:91/273 - (33%)
Similarity:130/273 - (47%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGI-SGAHSCGGAIIN 70
            ::||.:||  |:..:.:     .||.....||||||.|..|..|:|:|:..| :|...|||.:||
Zfish    12 VLLLNISG--SLCQLDV-----CGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGGLLCGGTLIN 69

  Fly    71 ETFVLTAAHCVENAFIPWLVVVTG------TNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLE 129
            ..:||:||.|.:......|||..|      .|..:.|..:     |..|..||:....||||||:
Zfish    70 REWVLSAAQCFQKLTASNLVVHLGHLSTGDPNVIHNPASQ-----IINHPKYDSATNKNDIALLK 129

  Fly   130 LVEPIAWDERTQPIPLPLVPMQPGDEVI--LTGWGSTVLWGTS-PIDLQVLYLQYVPHRECKAL- 190
            |..|:::.:..:|:.|.......|...:  :|||||....||. |..||.:.:..|.:.:||:. 
Zfish   130 LSTPVSFTDYIKPVCLTASGSSLGKGAVSWITGWGSINTGGTQFPTTLQEVKIPVVSNGDCKSAY 194

  Fly   191 --LSNDEDCDVGHICTF-SRLGEGACHGDSGGPLVSNG----YLVGLVNWGWPCATGV-PDVHAS 247
              |..|     |.||.. :..|:|.|.||.|||||.|.    ...|:.::|..||... |.|...
Zfish   195 GSLITD-----GMICAGPNEGGKGICMGDGGGPLVHNSSEQWIQSGIASFGRGCAQPKNPGVFTR 254

  Fly   248 VYFYRDWIRNVMS 260
            |..|..||::.:|
Zfish   255 VSEYESWIKSQIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 81/236 (34%)
Tryp_SPc 38..258 CDD:238113 82/238 (34%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 81/236 (34%)
Tryp_SPc 36..265 CDD:238113 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.