DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Ctrc

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:281 Identity:93/281 - (33%)
Similarity:138/281 - (49%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLSGLVSITAIRIKGNSTDGRFYKD--QRIIGGQAAEDGFAPYQISLQGI---SGAHSCGGAI 68
            :||::.|.:|.|  ...:..|..|..:  .|::||:.|.....|:|:|||.:   :..|:|||::
Mouse     1 MLGITVLAAILA--CASSCGDPTFPPNLSARVVGGEDAVPNSWPWQVSLQYLRDDTWRHTCGGSL 63

  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNKYN-----QPGGRYF-LKAIHIHCNYDNPEMHNDIAL 127
            |..:.|||||||: |..:.:.|   |..|||     :.|..|. :..|::|..::...:.||||:
Mouse    64 ITTSHVLTAAHCI-NTNLTYRV---GLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLLLWNDIAI 124

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQ----PGD-EVILTGWGSTVLWGTSPID--LQVLYLQYVPHR 185
            ::|.||:   |.:..|.:..:|.|    ||| ...:||||.  ||...||.  ||......|.|.
Mouse   125 IKLAEPV---ELSDTIQVACIPEQDSLLPGDYPCYVTGWGR--LWTNGPIAEVLQQGLQPIVNHT 184

  Fly   186 ECKAL----LSNDEDCDVGHICTFSRLGEG---ACHGDSGGPL---VSNG--YLVGLVNWGWP-- 236
            .|..|    :...|..    :|..   |:|   ||:|||||||   |.:|  .:.|:|::|..  
Mouse   185 TCSRLDWWFIKVRETM----VCAG---GDGVISACNGDSGGPLNCPVEDGLWQVHGIVSFGSSRG 242

  Fly   237 CAT-GVPDVHASVYFYRDWIR 256
            |.| ..|.|...|..|.|||:
Mouse   243 CNTYKKPVVFTRVSAYIDWIK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 84/248 (34%)
Tryp_SPc 38..258 CDD:238113 85/250 (34%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 84/248 (34%)
Tryp_SPc 30..265 CDD:238113 85/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.