DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:272 Identity:88/272 - (32%)
Similarity:133/272 - (48%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL-QGISGAHSC 64
            |..:.....||       .|:.:..||       |.:|:||........|||:|| .|||  |.|
Mouse     1 MKIITFFTFLG-------AAVALPANS-------DDKIVGGYTCPKHSVPYQVSLNDGIS--HQC 49

  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN-QPGGRYFLKAIHI--HCNYDNPEMHNDIA 126
            ||::|::.:||:||||.:..    |.|..|.:..: ..||..|:.|..|  |.:|:...:.|||.
Mouse    50 GGSLISDQWVLSAAHCYKRR----LQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIM 110

  Fly   127 LLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTV-LWGTSPIDLQVLYLQYVPHRECK-- 188
            |::|..|...:.:...:.||........:.:::|||:|| :.|..|..||.|....:....||  
Mouse   111 LIKLKSPAILNSQVSTVSLPRSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKS 175

  Fly   189 --ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYF 250
              ..::::..| :|    |...|:.:|.||||||:|.||.:.|:|:||..|| .|.|.|:..|..
Mouse   176 YPGQITSNMFC-LG----FLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCN 235

  Fly   251 YRDWIRNVMSGN 262
            |..||:..|:.|
Mouse   236 YLSWIQETMANN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/227 (34%)
Tryp_SPc 38..258 CDD:238113 79/229 (34%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 77/227 (34%)
Tryp_SPc 24..243 CDD:238113 79/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.