DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss59

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001348859.1 Gene:Prss59 / 73481 MGIID:1920731 Length:251 Species:Mus musculus


Alignment Length:215 Identity:51/215 - (23%)
Similarity:81/215 - (37%) Gaps:18/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHC 114
            ||.:.||  |....|.|.:|:..:|||||||.....|...|.........:....|....  :|.
Mouse    39 PYMVYLQ--SSPEPCVGTLIDPQWVLTAAHCSLPTKIRLGVYRPNIKNEKEQICNYSFTV--VHP 99

  Fly   115 NYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYL 179
            |:|...:.||:.|::|..|...:.....|.:.:.||...:...:..|........|..|:.....
Mouse   100 NFDAKLLKNDLMLIKLSYPATINMYVGTIAIAMEPMAFNESCFIPTWTWNNYKNLSDPDILTWIN 164

  Fly   180 QY-VPHRECKALLSNDED-------CDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG-W 235
            :| :...:|...|...:.       | :||    |.....|....|..|.:.:|.:.|:::|| .
Mouse   165 EYSLSPSDCLDTLHQQKQETRINIMC-IGH----SLNAMSATKEVSAAPAICSGRVHGILSWGKA 224

  Fly   236 PCATGVPDVHASVYFYRDWI 255
            ..|.|.......::.|..||
Mouse   225 SVANGSKGFFTEIHPYARWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 49/213 (23%)
Tryp_SPc 38..258 CDD:238113 51/215 (24%)
Prss59NP_001348859.1 Tryp_SPc 37..244 CDD:389826 49/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.