DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and orc1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001039194.1 Gene:orc1 / 734048 XenbaseID:XB-GENE-997997 Length:888 Species:Xenopus tropicalis


Alignment Length:158 Identity:30/158 - (18%)
Similarity:44/158 - (27%) Gaps:67/158 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 HCVENAFIPWLV----------VVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEP 133
            |..::|.:.|.:          .:.|...:.|   ..||        ||.|...|||....::..
 Frog    79 HTSKHAIVQWFLRYEEVPYRKRALLGREPHQQ---EIFL--------YDVPSCENDIDAETIIGR 132

  Fly   134 IAWDERTQPIPLPLVPMQ--PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDED 196
            :   |.||..|....|:|  .|...:...|..                     :..|.|.||   
 Frog   133 V---EVTQLKPEDSFPVQKDAGSLFVKLSWNG---------------------KAFKPLTSN--- 170

  Fly   197 CDVGHICTFSRLGEGACHGDSGGPLVSN 224
                           .||.|  |.:.:|
 Frog   171 ---------------VCHND--GVIAAN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 30/158 (19%)
Tryp_SPc 38..258 CDD:238113 30/158 (19%)
orc1NP_001039194.1 BAH_Orc1p_animal 45..169 CDD:240070 23/124 (19%)
AAA_16 532..>582 CDD:289934
AAA 554..704 CDD:214640
AAA 558..703 CDD:278434
Cdc6_C 798..881 CDD:176573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165166887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.