DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TPSAB1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:291 Identity:82/291 - (28%)
Similarity:117/291 - (40%) Gaps:65/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ--GISGAHSCGGAII 69
            |:||.|..|.|    |.......|:..:...|:|||.|.....|:|:||:  |....|.|||::|
Human     4 LLLLALPVLAS----RAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLI 64

  Fly    70 NETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIH--------------IHCNYDNPE 120
            :..:||||||||            |.:..:....|..|:..|              :|..:...:
Human    65 HPQWVLTAAHCV------------GPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQ 117

  Fly   121 MHNDIALLELVEPIAWDERTQPIPLPLV--PMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVP 183
            :..|||||||.||:........:.||..  ...||....:||||.        :|.........|
Human   118 IGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGD--------VDNDERLPPPFP 174

  Fly   184 HRECKALLSNDEDCDVGH-----------------ICTFSRLGEGACHGDSGGPLVS--NG--YL 227
            .::.|..:..:..||..:                 :|. ......:|.||||||||.  ||  ..
Human   175 LKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCA-GNTRRDSCQGDSGGPLVCKVNGTWLQ 238

  Fly   228 VGLVNWGWPCA-TGVPDVHASVYFYRDWIRN 257
            .|:|:||..|| ...|.::..|.:|.|||.:
Human   239 AGVVSWGEGCAQPNRPGIYTRVTYYLDWIHH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/257 (28%)
Tryp_SPc 38..258 CDD:238113 74/260 (28%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 73/257 (28%)
Tryp_SPc 31..267 CDD:214473 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.