DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss55

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:255 Identity:87/255 - (34%)
Similarity:121/255 - (47%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHC--VENAFIPWLVVVTGTNKYN 99
            |||.||.||.|..|:|:|:|. |..|.|||:|::|.::||.|||  .:......|.|..|||...
Mouse    60 RIIEGQEAELGEFPWQVSIQE-SDHHFCGGSILSEWWILTVAHCFYAQELSPTDLRVRVGTNDLT 123

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG-DEVILTGWGS 163
            .......:..|..|..:....|.||||||.|.:|:.::|.|.||.|||.|..|. .|..:.|||.
Mouse   124 TSPVELEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNELTVPICLPLWPAPPSWHECWVAGWGV 188

  Fly   164 TVLWGTSPI--DLQVLYLQYVPHRECKAL---LSNDEDCDVGHICTFSRLGEGACHGDSGGPLV- 222
            |.......:  ||..:.::.:...||..:   |:.:..|     .::......||.|||||||| 
Mouse   189 TNSTDKESMSTDLMKVPMRIIEWEECLQMFPSLTTNMLC-----ASYGNESYDACQGDSGGPLVC 248

  Fly   223 -----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGNSKCTGF----SSNQ 272
                 |..|.||:::||..|. .|.|.::..:..|..||..:.....|...|    |||:
Mouse   249 TTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTLWIEKIAQTEGKPLDFRGQSSSNK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/232 (34%)
Tryp_SPc 38..258 CDD:238113 81/234 (35%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.