DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss54

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006531428.1 Gene:Prss54 / 70993 MGIID:1918243 Length:429 Species:Mus musculus


Alignment Length:287 Identity:62/287 - (21%)
Similarity:108/287 - (37%) Gaps:76/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLS-------GLVSIT-AIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGA 61
            :||:||.:|       |:...| |.::|.|......:                |:.:|:|.....
Mouse    53 MLLMLLYISHSSSAICGIQKATIADKLKENLVSSTEF----------------PWVVSIQDKQYT 101

  Fly    62 HSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN---QPGGRYFLKAIHIHCNYDNPEMHN 123
            |...|.|::|.::|:.|..:::.  ..::.|.|.:..:   .....|.:..|..|.|:||..|.|
Mouse   102 HLAFGCILSEFWILSTASALQHR--KEVIAVVGISNMDPRKTDHREYSVNTIIPHENFDNVSMGN 164

  Fly   124 DIALLELVEPIAWDERTQPI---------PLPLVPMQPGDEVILTGWGST----------VLWGT 169
            :||||:....:.:::..|.|         |..|      ....:.||..|          :|...
Mouse   165 NIALLKTESAMHFNDLVQAICFLGKKLHKPPAL------KNCWVAGWNPTSATGNHMTMSILRRI 223

  Fly   170 SPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNG------YLV 228
            |..|::|..|:.....||               .:.::.....|.|:.|.|::...      .|.
Mouse   224 SVKDIEVCPLRRHQKTEC---------------ASHTKEPNNVCLGEPGSPMMCQAKKLDLWILR 273

  Fly   229 GLVNWGWPCATGVPDVHASVYFYRDWI 255
            ||:.:|.....|: .::.||..|.|||
Mouse   274 GLLAYGGDSCPGL-FLYTSVADYSDWI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 50/245 (20%)
Tryp_SPc 38..258 CDD:238113 52/246 (21%)
Prss54XP_006531428.1 Tryp_SPc 88..299 CDD:238113 50/250 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.