DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk12

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:280 Identity:85/280 - (30%)
Similarity:121/280 - (43%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH-SCG 65
            |.::||..:|||     .|.|             ::|..|........|:|:.|  ..|.: .||
Mouse     4 SILLLLCAVGLS-----QADR-------------EKIYNGVECVKNSQPWQVGL--FHGKYLRCG 48

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAI-------HIHCNYDNPEM-- 121
            |.:::..:|||||||              .:||....|.:.|..:       |...:..:|..  
Mouse    49 GVLVDRKWVLTAAHC--------------RDKYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQG 99

  Fly   122 -----HNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGST-VLWGTSPIDLQVLYLQ 180
                 .:|:.||.|..||......:|:.||...:..|....::|||:| ..|...|..||.|.|.
Mouse   100 AYQNHEHDLRLLRLNRPIHLTRAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLS 164

  Fly   181 YVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG--WPCA-TGVP 242
            .|.:..|:|:.......::  :|.....|:.||.||||||||..|.|.|||:||  .||. .|:|
Mouse   165 TVSNETCRAVFPGRVTENM--LCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIP 227

  Fly   243 DVHASVYFYRDWIRNVMSGN 262
            .|:..|..|.||||.|:..|
Mouse   228 GVYTKVCKYTDWIRIVIRNN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/236 (31%)
Tryp_SPc 38..258 CDD:238113 75/238 (32%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.