DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss56

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:254 Identity:74/254 - (29%)
Similarity:112/254 - (44%) Gaps:50/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAF--IPWLVVVTGTNKYN 99
            ||:||..|..|..|:.:.|| :.|...|||.::..::|||||||...|.  :.|.|::.     .
Mouse   109 RIVGGSTAPSGAWPWLVRLQ-LGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLA-----E 167

  Fly   100 QPGGRYF----LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP--GDEVIL 158
            .|.|...    :..|..|..:|....|||:||::|..|::.:...:||.||....:|  |....:
Mouse   168 GPQGEQAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVSPEGPARPICLPQGSREPPAGTPCAI 232

  Fly   159 TGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCD--------------VGHICTFSRLG 209
            .|||:  |:...|....|        ||.:..|.:.:.|.              .|::..    |
Mouse   233 AGWGA--LFEDGPESEAV--------REARVPLLSADTCQKVLGPGLRPSTMLCAGYLAG----G 283

  Fly   210 EGACHGDSGGPLVSN-------GYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMS 260
            ..:|.|||||||..:       ..|.|:.:||..|. .|.|.|:..|..::||::..||
Mouse   284 IDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVTVFKDWLQEQMS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/247 (29%)
Tryp_SPc 38..258 CDD:238113 71/249 (29%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 70/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.