DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Proz

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_080110.1 Gene:Proz / 66901 MGIID:1860488 Length:399 Species:Mus musculus


Alignment Length:243 Identity:57/243 - (23%)
Similarity:90/243 - (37%) Gaps:71/243 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHC 114
            |:|:.|....|...|.|.::.|.||||.|.|        .::.:..:.......|..:|:.|:|.
Mouse   194 PWQVRLTNSEGEDFCAGVLLQEDFVLTTAKC--------SLLHSNISVKANVDQRIRIKSTHVHM 250

  Fly   115 NYDNPEMHNDIALLELVEPIAWDERTQPIPLP--------LVPMQPGDEVILTGW--GSTVLWGT 169
            .||.....||::||:|.||:.......|:.:|        |:   ||.|.:|:||  ..|.| .|
Mouse   251 RYDEESGENDVSLLQLEEPLQCPSSGLPVCVPERDFAEHVLI---PGTEGLLSGWMLNGTHL-AT 311

  Fly   170 SPIDLQVLYLQYVPHREC----KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNG----- 225
            :|:   :|.:......||    ...::....|:.|.:..              ||.|...     
Mouse   312 TPM---LLSVTQADGEECGQTLNVTVTTRTSCEKGSVVM--------------GPWVEGSVVTRE 359

  Fly   226 -----YLVGLVNWGWP---------CATGVPDVHASVYFYRDWIRNVM 259
                 :|.|::  |.|         ..|.||.       |..|.:.:|
Mouse   360 HKGTWFLTGIL--GSPPPPGQSQMLLLTAVPR-------YSMWFKQIM 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 55/237 (23%)
Tryp_SPc 38..258 CDD:238113 56/240 (23%)
ProzNP_080110.1 GLA 23..85 CDD:214503
EGF_CA <95..122 CDD:238011
FXa_inhibition 136..165 CDD:291342
Tryp_SPc 192..397 CDD:304450 56/240 (23%)
Trypsin 192..>340 CDD:278516 42/160 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7840
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.