DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and prss1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:273 Identity:78/273 - (28%)
Similarity:129/273 - (47%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |.|.:||.|..::....:      |:.       |.:|:||........|||:||.  ||.|.||
Zfish     1 MKAFILLALFAVAYAAPL------GDD-------DDKIVGGYECTKNGVPYQVSLN--SGYHFCG 50

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN---QPGGRYFLKAIHI--HCNYDNPEMHNDI 125
            |::|:..:|::||||.::.      |.....::|   ..|...|:.:..:  |.:|::..:.||:
Zfish    51 GSLISNLWVVSAAHCYKSR------VQVRLGEHNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDV 109

  Fly   126 ALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTS-PIDLQVLYLQYVPHRECK- 188
            .|::|......:...:.:.||......|...:::|||:....|:: |..|..|....:....|: 
Zfish   110 MLIKLSSSAQINSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRN 174

  Fly   189 ---ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVY 249
               ..:|::..|     ..|...|:.:|.||||||:|.|..|.|:|:||:.|| ...|.|:|.|.
Zfish   175 AYPGQISSNMFC-----AGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVC 234

  Fly   250 FYRDWIRNVMSGN 262
            .:..||||.|:.|
Zfish   235 NFTTWIRNTMNSN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/228 (29%)
Tryp_SPc 38..258 CDD:238113 68/230 (30%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 65/228 (29%)
Tryp_SPc 25..243 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.